Lineage for d6hcnc_ (6hcn C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776830Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. 2776955Species Human adenovirus type 5 [TaxId:28285] [49838] (2 PDB entries)
  8. 2776958Domain d6hcnc_: 6hcn C: [364829]
    automated match to d1knba_
    complexed with edo, mg

Details for d6hcnc_

PDB Entry: 6hcn (more details), 1.49 Å

PDB Description: adenovirus type 5 fiber knob protein at 1.49a resolution
PDB Compounds: (C:) fiber protein

SCOPe Domain Sequences for d6hcnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcnc_ b.21.1.1 (C:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 5 [TaxId: 28285]}
ndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvqsa
hliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktaksn
ivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssytf
syiaqe

SCOPe Domain Coordinates for d6hcnc_:

Click to download the PDB-style file with coordinates for d6hcnc_.
(The format of our PDB-style files is described here.)

Timeline for d6hcnc_: