Lineage for d6hcna_ (6hcn A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. Species Human adenovirus type 5 [TaxId:28285] [49838] (2 PDB entries)
  8. Domain d6hcna_: 6hcn A: [364824]
    automated match to d1knba_
    complexed with edo, mg

Details for d6hcna_

PDB Entry: 6hcn (more details), 1.49 Å

PDB Description: adenovirus type 5 fiber knob protein at 1.49a resolution
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d6hcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcna_ b.21.1.1 (A:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 5 [TaxId: 28285]}
ndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvqsa
hliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktaksn
ivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssytf
syiaqe

SCOPe Domain Coordinates for d6hcna_ are not available.

Timeline for d6hcna_:

Domains from other chains:
(mouse over for more information)
d6hcnb_, d6hcnc_