PDB entry 6hcn

View 6hcn on RCSB PDB site
Description: Adenovirus Type 5 Fiber Knob protein at 1.49A resolution
Class: viral protein
Keywords: Fiber, Fiber-knob, tropism determinant, high resolution, structure determination. adenovirus, Mastadenovirus, VIRAL PROTEIN
Deposited on 2018-08-15, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: Human adenovirus 5 [TaxId:28285]
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hcna_
  • Chain 'B':
    Compound: fiber protein
    Species: Human adenovirus 5 [TaxId:28285]
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hcnb_
  • Chain 'C':
    Compound: fiber protein
    Species: Human adenovirus 5 [TaxId:28285]
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hcnc_
  • Heterogens: EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hcnA (A:)
    ndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvqsa
    hliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktaksn
    ivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssytf
    syiaqe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hcnB (B:)
    knndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvq
    sahliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktak
    snivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssy
    tfsyiaqe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hcnC (C:)
    ndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvqsa
    hliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktaksn
    ivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssytf
    syiaqe