Lineage for d6j9tf2 (6j9t F:151-318)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999316Species Lactobacillus casei [TaxId:219334] [364536] (3 PDB entries)
  8. 2999328Domain d6j9tf2: 6j9t F:151-318 [364633]
    Other proteins in same PDB: d6j9ta1, d6j9tb1, d6j9tc1, d6j9td1, d6j9te1, d6j9tf1
    automated match to d1llca2
    complexed with fbp, so4

Details for d6j9tf2

PDB Entry: 6j9t (more details), 2.7 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate
PDB Compounds: (F:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9tf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j9tf2 d.162.1.1 (F:151-318) automated matches {Lactobacillus casei [TaxId: 219334]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafa

SCOPe Domain Coordinates for d6j9tf2:

Click to download the PDB-style file with coordinates for d6j9tf2.
(The format of our PDB-style files is described here.)

Timeline for d6j9tf2: