![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
![]() | Protein automated matches [226882] (10 species) not a true protein |
![]() | Species Lactobacillus casei [TaxId:219334] [364536] (3 PDB entries) |
![]() | Domain d6j9td2: 6j9t D:151-317 [364629] Other proteins in same PDB: d6j9ta1, d6j9tb1, d6j9tc1, d6j9td1, d6j9te1, d6j9tf1 automated match to d1llca2 complexed with fbp, so4 |
PDB Entry: 6j9t (more details), 2.7 Å
SCOPe Domain Sequences for d6j9td2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j9td2 d.162.1.1 (D:151-317) automated matches {Lactobacillus casei [TaxId: 219334]} tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf
Timeline for d6j9td2: