SCOPe 2.07: Domain d6j9td2: 6j9t D:151-317

Lineage for d6j9td2 (6j9t D:151-317)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Lactobacillus casei [TaxId:219334] [364536] (3 PDB entries)

8. Domain d6j9td2: 6j9t D:151-317 [364629]
   Other proteins in same PDB: d6j9ta1, d6j9tb1, d6j9tc1, d6j9td1, d6j9te1, d6j9tf1
   automated match to d1llca2
   complexed with fbp, so4

Details for d6j9td2

PDB Entry: 6j9t, 2.7 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9td2:

Sequence; same for both SEQRES and ATOM records:

>d6j9td2 d.162.1.1 (D:151-317) automated matches {Lactobacillus casei [TaxId: 219334]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf

Timeline for d6j9td2:

• d6j9td2 is new in SCOPe 2.07-stable
  
• d6j9td2 appears in the current release, SCOPe 2.08