Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein automated matches [226881] (8 species) not a true protein |
Species Lactobacillus casei [TaxId:219334] [364534] (3 PDB entries) |
Domain d6j9te1: 6j9t E:4-150 [364617] Other proteins in same PDB: d6j9ta2, d6j9tb2, d6j9tc2, d6j9td2, d6j9te2, d6j9tf2 automated match to d1llca1 complexed with fbp, so4 |
PDB Entry: 6j9t (more details), 2.7 Å
SCOPe Domain Sequences for d6j9te1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j9te1 c.2.1.5 (E:4-150) automated matches {Lactobacillus casei [TaxId: 219334]} itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftsp kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv aanpvdiltyatwklsgfpknrvvgsg
Timeline for d6j9te1: