Lineage for d6j5dl_ (6j5d L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744407Domain d6j5dl_: 6j5d L: [364619]
    Other proteins in same PDB: d6j5da_, d6j5dh1, d6j5dh2
    automated match to d1vfaa_

Details for d6j5dl_

PDB Entry: 6j5d (more details), 1.8 Å

PDB Description: complex structure of mab 4.2-scfv with louping ill virus envelope protein domain iii
PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d6j5dl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j5dl_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvykaqtladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstppwtfgggtkleik

SCOPe Domain Coordinates for d6j5dl_:

Click to download the PDB-style file with coordinates for d6j5dl_.
(The format of our PDB-style files is described here.)

Timeline for d6j5dl_: