SCOPe 2.08: Domain d6j5dh1: 6j5d H:9-120

Lineage for d6j5dh1 (6j5d H:9-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6j5dh1: 6j5d H:9-120 [364605]
   Other proteins in same PDB: d6j5da_, d6j5dh2, d6j5dl_
   automated match to d5i0za_

Details for d6j5dh1

PDB Entry: 6j5d, 1.8 Å

PDB Description: complex structure of mab 4.2-scfv with louping ill virus envelope protein domain iii

PDB Compounds: (H:) antibody heavy chain

SCOPe Domain Sequences for d6j5dh1:

Sequence; same for both SEQRES and ATOM records:

>d6j5dh1 b.1.1.0 (H:9-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelvkpgasvkmsckasgytftdyvigwvkqrtgqglewigeiypgsgttyynekfkdka
tltadkssntaymqlssltsedsavyfcargedgyyialdywgqgttvtvss

Timeline for d6j5dh1:

• d6j5dh1 first appeared in SCOPe 2.07