Lineage for d5z6na_ (5z6n A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969065Species Escherichia coli [TaxId:83333] [260781] (4 PDB entries)
  8. 2969071Domain d5z6na_: 5z6n A: [364304]
    automated match to d1xeba_

Details for d5z6na_

PDB Entry: 5z6n (more details), 2.6 Å

PDB Description: crystal structure of escherichia coli elaa
PDB Compounds: (A:) Protein ElaA

SCOPe Domain Sequences for d5z6na_:

Sequence, based on SEQRES records: (download)

>d5z6na_ d.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
iewqdlhhselsvsqlyallqlrcavfvveqncpyqdidgddltgdnrhilgwkndelva
yarilksdddlepvvigrvivsealrgekvgqqlmsktletcthhwpdkpvylgaqahlq
nfyqsfgfipvtevyeedgiphigmare

Sequence, based on observed residues (ATOM records): (download)

>d5z6na_ d.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
iewqdlhhselsvsqlyallqlrcavfvveqncpyqdidgddltgdnrhilgwkndelva
yarilkslepvvigrvivsealrgekvgqqlmsktletcthhwpdkpvylgaqahlqnfy
qsfgfipvtevyeediphigmare

SCOPe Domain Coordinates for d5z6na_:

Click to download the PDB-style file with coordinates for d5z6na_.
(The format of our PDB-style files is described here.)

Timeline for d5z6na_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5z6nb_