PDB entry 5z6n

View 5z6n on RCSB PDB site
Description: Crystal structure of Escherichia coli ElaA
Class: transferase
Keywords: N-acetyltransferase, acetyl coenzyme A, TRANSFERASE
Deposited on 2018-01-23, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ElaA
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: elaA, yfbC, b2267, JW2262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z6na_
  • Chain 'B':
    Compound: Protein ElaA
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: elaA, yfbC, b2267, JW2262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z6nb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z6nA (A:)
    miewqdlhhselsvsqlyallqlrcavfvveqncpyqdidgddltgdnrhilgwkndelv
    ayarilksdddlepvvigrvivsealrgekvgqqlmsktletcthhwpdkpvylgaqahl
    qnfyqsfgfipvtevyeedgiphigmareviqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6nA (A:)
    iewqdlhhselsvsqlyallqlrcavfvveqncpyqdidgddltgdnrhilgwkndelva
    yarilkslepvvigrvivsealrgekvgqqlmsktletcthhwpdkpvylgaqahlqnfy
    qsfgfipvtevyeediphigmare
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z6nB (B:)
    miewqdlhhselsvsqlyallqlrcavfvveqncpyqdidgddltgdnrhilgwkndelv
    ayarilksdddlepvvigrvivsealrgekvgqqlmsktletcthhwpdkpvylgaqahl
    qnfyqsfgfipvtevyeedgiphigmareviqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6nB (B:)
    miewqdlhhselsvsqlyallqlrcavfvveqncpyqdidgddltgdnrhilgwkndelv
    ayarilksdddlepvvigrvivsealrgekvgqqlmsktletcthhwpdkpvylgaqahl
    qnfyqsfgfipvtevyeedgphigmare