SCOPe 2.08: Domain d6hw3c1: 6hw3 C:1-234

Lineage for d6hw3c1 (6hw3 C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d6hw3c1: 6hw3 C:1-234 [364170]
   Other proteins in same PDB: d6hw3b_, d6hw3c2, d6hw3e_, d6hw3g_, d6hw3i_, d6hw3j_, d6hw3k_, d6hw3l_, d6hw3n_, d6hw3o_, d6hw3q2, d6hw3s_, d6hw3u_, d6hw3w_, d6hw3x_, d6hw3y_, d6hw3z_
   automated match to d1rypd_
   complexed with cl, gqt, mg

Details for d6hw3c1

PDB Entry: 6hw3, 2.6 Å

PDB Description: yeast 20s proteasome in complex with 13

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hw3c1:

Sequence; same for both SEQRES and ATOM records:

>d6hw3c1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d6hw3c1:

• d6hw3c1 first appeared in SCOPe 2.07, called d6hw3c_