Lineage for d6hw3o_ (6hw3 O:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2988657Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2989640Domain d6hw3o_: 6hw3 O: [364107]
    Other proteins in same PDB: d6hw3a_, d6hw3c1, d6hw3c2, d6hw3d_, d6hw3f_, d6hw3g_, d6hw3h_, d6hw3m_, d6hw3p_, d6hw3q1, d6hw3q2, d6hw3r_, d6hw3t_, d6hw3u_, d6hw3v_
    automated match to d1rypb_
    complexed with cl, gqt, mg

Details for d6hw3o_

PDB Entry: 6hw3 (more details), 2.6 Å

PDB Description: yeast 20s proteasome in complex with 13
PDB Compounds: (O:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d6hw3o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw3o_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d6hw3o_:

Click to download the PDB-style file with coordinates for d6hw3o_.
(The format of our PDB-style files is described here.)

Timeline for d6hw3o_: