Lineage for d6hwdc1 (6hwd C:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2988657Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2990062Domain d6hwdc1: 6hwd C:1-234 [364123]
    Other proteins in same PDB: d6hwdb_, d6hwdc2, d6hwdh_, d6hwdi_, d6hwdj_, d6hwdk_, d6hwdl_, d6hwdm_, d6hwdn_, d6hwdq2, d6hwdv_, d6hwdw_, d6hwdx_, d6hwdy_, d6hwdz_
    automated match to d4cr2d_
    complexed with bo2, cl, mg; mutant

Details for d6hwdc1

PDB Entry: 6hwd (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-g45a mutant in complex with bortezomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hwdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hwdc1 d.153.1.4 (C:1-234) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d6hwdc1:

Click to download the PDB-style file with coordinates for d6hwdc1.
(The format of our PDB-style files is described here.)

Timeline for d6hwdc1:

  • d6hwdc1 first appeared in SCOPe 2.07, called d6hwdc_