Lineage for d6hubc_ (6hub C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2594900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2596667Domain d6hubc_: 6hub C: [363508]
    Other proteins in same PDB: d6hubb_, d6hubh_, d6hubi_, d6hubj_, d6hubk_, d6hubl_, d6hubm_, d6hubn_, d6hubv_, d6hubw_, d6hubx_, d6huby_, d6hubz_
    automated match to d4cr2d_
    complexed with cl, grw, mg, so4

Details for d6hubc_

PDB Entry: 6hub (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 16
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hubc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hubc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d6hubc_:

Click to download the PDB-style file with coordinates for d6hubc_.
(The format of our PDB-style files is described here.)

Timeline for d6hubc_:

  • d6hubc_ is new in SCOPe 2.07-stable
  • d6hubc_ appears in the current release, SCOPe 2.08, called d6hubc1