Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6hubm_: 6hub M: [363424] Other proteins in same PDB: d6huba_, d6hubb_, d6hubc_, d6hubd_, d6hube_, d6hubf_, d6hubg_, d6hubi_, d6hubj_, d6hubk_, d6hubl_, d6hubn_, d6hubo_, d6hubp_, d6hubq_, d6hubr_, d6hubs_, d6hubt_, d6hubu_, d6hubw_, d6hubx_, d6huby_, d6hubz_ automated match to d4j70m_ complexed with cl, grw, mg, so4 |
PDB Entry: 6hub (more details), 2.9 Å
SCOPe Domain Sequences for d6hubm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hubm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakd
Timeline for d6hubm_: