Lineage for d6hubm_ (6hub M:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2601122Domain d6hubm_: 6hub M: [363424]
    Other proteins in same PDB: d6huba_, d6hubb_, d6hubc_, d6hubd_, d6hube_, d6hubf_, d6hubg_, d6hubi_, d6hubj_, d6hubk_, d6hubl_, d6hubn_, d6hubo_, d6hubp_, d6hubq_, d6hubr_, d6hubs_, d6hubt_, d6hubu_, d6hubw_, d6hubx_, d6huby_, d6hubz_
    automated match to d4j70m_
    complexed with cl, grw, mg, so4

Details for d6hubm_

PDB Entry: 6hub (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 16
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6hubm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hubm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakd

SCOPe Domain Coordinates for d6hubm_:

Click to download the PDB-style file with coordinates for d6hubm_.
(The format of our PDB-style files is described here.)

Timeline for d6hubm_: