![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein automated matches [190370] (2 species) not a true protein |
![]() | Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [361055] (2 PDB entries) |
![]() | Domain d6fg5a_: 6fg5 A: [363212] automated match to d3g58a_ complexed with mg, zn |
PDB Entry: 6fg5 (more details), 2.35 Å
SCOPe Domain Sequences for d6fg5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fg5a_ a.211.1.2 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} flpihgvetpndneleerfslcldewgvdifeidrlsnghalttvayrifqkrdllktfc idphvfvryllrvestyhadvpyhnsmhaadvlqtahfllqaealddvfsdleilavlfa aaihdvdhpgvtnqflintghelalqyndasvlenhhlymafkiltekdcdifanlggkk rqtlrrmvielvlatdmskhmslladlrtmvetkkvsgsgmlnldnyadriqilqnmihc adlsnpakplrlyrkwtgrlieeffrqgdkerelsleispmcdresveveksqvsfidfv chplwetwcdlvhpcaqlildtlednrdwyechi
Timeline for d6fg5a_: