PDB entry 6fg5

View 6fg5 on RCSB PDB site
Description: Schistosoma mansoni Phosphodiesterase 4A
Class: hydrolase
Keywords: cAMP complex, hydrolase, phosphodiesterase
Deposited on 2018-01-10, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphodiesterase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_134140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fg5a_
  • Chain 'B':
    Compound: phosphodiesterase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_134140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fg5b_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fg5A (A:)
    gpaqlndssgllttklpssskltsqnvddgngpflpihgvetpndneleerfslcldewg
    vdifeidrlsnghalttvayrifqkrdllktfcidphvfvryllrvestyhadvpyhnsm
    haadvlqtahfllqaealddvfsdleilavlfaaaihdvdhpgvtnqflintghelalqy
    ndasvlenhhlymafkiltekdcdifanlggkkrqtlrrmvielvlatdmskhmslladl
    rtmvetkkvsgsgmlnldnyadriqilqnmihcadlsnpakplrlyrkwtgrlieeffrq
    gdkerelsleispmcdresveveksqvsfidfvchplwetwcdlvhpcaqlildtlednr
    dwyechikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fg5A (A:)
    flpihgvetpndneleerfslcldewgvdifeidrlsnghalttvayrifqkrdllktfc
    idphvfvryllrvestyhadvpyhnsmhaadvlqtahfllqaealddvfsdleilavlfa
    aaihdvdhpgvtnqflintghelalqyndasvlenhhlymafkiltekdcdifanlggkk
    rqtlrrmvielvlatdmskhmslladlrtmvetkkvsgsgmlnldnyadriqilqnmihc
    adlsnpakplrlyrkwtgrlieeffrqgdkerelsleispmcdresveveksqvsfidfv
    chplwetwcdlvhpcaqlildtlednrdwyechi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fg5B (B:)
    gpaqlndssgllttklpssskltsqnvddgngpflpihgvetpndneleerfslcldewg
    vdifeidrlsnghalttvayrifqkrdllktfcidphvfvryllrvestyhadvpyhnsm
    haadvlqtahfllqaealddvfsdleilavlfaaaihdvdhpgvtnqflintghelalqy
    ndasvlenhhlymafkiltekdcdifanlggkkrqtlrrmvielvlatdmskhmslladl
    rtmvetkkvsgsgmlnldnyadriqilqnmihcadlsnpakplrlyrkwtgrlieeffrq
    gdkerelsleispmcdresveveksqvsfidfvchplwetwcdlvhpcaqlildtlednr
    dwyechikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fg5B (B:)
    flpihgvetpndneleerfslcldewgvdifeidrlsnghalttvayrifqkrdllktfc
    idphvfvryllrvestyhadvpyhnsmhaadvlqtahfllqaealddvfsdleilavlfa
    aaihdvdhpgvtnqflintghelalqyndasvlenhhlymafkiltekdcdifanlggkk
    rqtlrrmvielvlatdmskhmslladlrtmvetkldnyadriqilqnmihcadlsnpakp
    lrlyrkwtgrlieeffrqgdkerelsleispmcdresveveksqvsfidfvchplwetwc
    dlvhpcaqlildtlednrdwyechi