Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
Protein automated matches [232306] (2 species) not a true protein |
Species Homo sapiens [TaxId:9606] [362871] (13 PDB entries) |
Domain d6q91c1: 6q91 C:2-216 [362942] Other proteins in same PDB: d6q91a2, d6q91a3, d6q91b2, d6q91b3, d6q91c2, d6q91c3, d6q91d2 automated match to d1wuua1 complexed with gal, hfk, hr8 |
PDB Entry: 6q91 (more details), 2.4 Å
SCOPe Domain Sequences for d6q91c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q91c1 d.14.1.5 (C:2-216) automated matches {Homo sapiens [TaxId: 9606]} aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp cgimdqfislmgqkghallidcrsletslvplsdp
Timeline for d6q91c1: