Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.7: Galactokinase [103011] (2 proteins) |
Protein automated matches [362873] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [362874] (13 PDB entries) |
Domain d6q91a2: 6q91 A:217-392 [362875] Other proteins in same PDB: d6q91a1, d6q91a3, d6q91b1, d6q91b3, d6q91c1, d6q91c3, d6q91d1 automated match to d1wuua2 complexed with gal, hfk, hr8 |
PDB Entry: 6q91 (more details), 2.4 Å
SCOPe Domain Sequences for d6q91a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q91a2 d.58.26.7 (A:217-392) automated matches {Homo sapiens [TaxId: 9606]} klavlitnsnvrhslasseypvrrrqceevaralgaaslrevqleeleaardlvskegfr rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl
Timeline for d6q91a2: