Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries) |
Domain d6hvoc1: 6hvo C:1-126 [362739] Other proteins in same PDB: d6hvoa3, d6hvoc3 automated match to d1plqa1 complexed with so4 |
PDB Entry: 6hvo (more details), 2.1 Å
SCOPe Domain Sequences for d6hvoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvoc1 d.131.1.0 (C:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd ldveql
Timeline for d6hvoc1: