Lineage for d6hvoc2 (6hvo C:127-256)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2583903Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries)
  8. 2583909Domain d6hvoc2: 6hvo C:127-256 [362740]
    Other proteins in same PDB: d6hvoa3, d6hvoc3
    automated match to d1plqa2
    complexed with so4

Details for d6hvoc2

PDB Entry: 6hvo (more details), 2.1 Å

PDB Description: crystal structure of human pcna in complex with three peptides of p12 subunit of human polymerase delta
PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6hvoc2:

Sequence, based on SEQRES records: (download)

>d6hvoc2 d.131.1.0 (C:127-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapkie

Sequence, based on observed residues (ATOM records): (download)

>d6hvoc2 d.131.1.0 (C:127-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqte
eavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyyla
pkie

SCOPe Domain Coordinates for d6hvoc2:

Click to download the PDB-style file with coordinates for d6hvoc2.
(The format of our PDB-style files is described here.)

Timeline for d6hvoc2: