Lineage for d6hvoc1 (6hvo C:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977364Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries)
  8. 2977369Domain d6hvoc1: 6hvo C:1-126 [362739]
    Other proteins in same PDB: d6hvoa3, d6hvoc3
    automated match to d1plqa1
    complexed with so4

Details for d6hvoc1

PDB Entry: 6hvo (more details), 2.1 Å

PDB Description: crystal structure of human pcna in complex with three peptides of p12 subunit of human polymerase delta
PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6hvoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvoc1 d.131.1.0 (C:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d6hvoc1:

Click to download the PDB-style file with coordinates for d6hvoc1.
(The format of our PDB-style files is described here.)

Timeline for d6hvoc1: