Lineage for d1b27c_ (1b27 C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein Barnase/Binase [53944] (2 species) Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries) 
Domain d1b27c_: 1b27 C: [36225]
Other proteins in same PDB: d1b27d_, d1b27e_, d1b27f_
Details for d1b27c_
PDB Entry: 1b27 (more details), 2.1 Å
PDB Description: structural response to mutation at a protein-protein interface
SCOP Domain Sequences for d1b27c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b27c_ d.1.1.1 (C:) Barnase/Binase {Bacillus amyloliquefaciens}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
SCOP Domain Coordinates for d1b27c_:
Click to download the PDB-style file with coordinates for d1b27c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b27c_:
- d1b27c_ appears in SCOP 1.57
- d1b27c_ appears in the current release, SCOPe 2.08
View in 3D
