Lineage for d6cwgb_ (6cwg B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745606Domain d6cwgb_: 6cwg B: [362132]
    Other proteins in same PDB: d6cwga_, d6cwgc_
    automated match to d1mqkh_
    complexed with cl

Details for d6cwgb_

PDB Entry: 6cwg (more details), 2.6 Å

PDB Description: ricin catalytic subunit bound go a9 vhh antibody
PDB Compounds: (B:) VHH Antibody

SCOPe Domain Sequences for d6cwgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cwgb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qlaesggglvqaggslklscaasgrdfsmymlawfrqapgkerefvaaimcsgggggtyy
adsmqgrftisrdnakktvalqmnslkpedtavyycaasttycsattyssdrlydfwgqg
tqvtvss

SCOPe Domain Coordinates for d6cwgb_:

Click to download the PDB-style file with coordinates for d6cwgb_.
(The format of our PDB-style files is described here.)

Timeline for d6cwgb_: