PDB entry 6cwg

View 6cwg on RCSB PDB site
Description: Ricin catalytic subunit bound go A9 VHH antibody
Class: immune system
Keywords: Ricin catalytic subunit, VHH antibody, IMMUNE SYSTEM
Deposited on 2018-03-30, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cwga_
  • Chain 'B':
    Compound: VHH Antibody
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CWG
    Domains in SCOPe 2.07: d6cwgb_
  • Chain 'C':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cwgc_
  • Chain 'D':
    Compound: VHH Antibody
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CWG
    Domains in SCOPe 2.07: d6cwgd_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cwgA (A:)
    mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
    velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
    ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
    rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
    fsvydvsilipiialmvyrcapppssqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cwgA (A:)
    qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
    haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
    rleqlagnlrenielgngpleeaisalyyystgtqlptlarsfiiciqmiseaarfqyie
    gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
    silipiialmvyrcapppssqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cwgB (B:)
    qvqlaesggglvqaggslklscaasgrdfsmymlawfrqapgkerefvaaimcsgggggt
    yyadsmqgrftisrdnakktvalqmnslkpedtavyycaasttycsattyssdrlydfwg
    qgtqvtvssepktpkpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cwgB (B:)
    qlaesggglvqaggslklscaasgrdfsmymlawfrqapgkerefvaaimcsgggggtyy
    adsmqgrftisrdnakktvalqmnslkpedtavyycaasttycsattyssdrlydfwgqg
    tqvtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cwgC (C:)
    mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
    velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
    ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
    rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
    fsvydvsilipiialmvyrcapppssqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cwgC (C:)
    qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
    haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
    rleqlagnlrenielgngpleeaisalyyystgtqlptlarsfiiciqmiseaarfqyie
    gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
    silipiialmvyrcappps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cwgD (D:)
    qvqlaesggglvqaggslklscaasgrdfsmymlawfrqapgkerefvaaimcsgggggt
    yyadsmqgrftisrdnakktvalqmnslkpedtavyycaasttycsattyssdrlydfwg
    qgtqvtvssepktpkpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cwgD (D:)
    qlaesggglvqaggslklscaasgrdfsmymlawfrqapgkerefvaaimcsgggggtyy
    adsmqgrftisrdnakktvalqmnslkpedtavyycaasttycsattyssdrlydfwgqg
    tqvtvss