![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
![]() | Protein Barnase [81305] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries) |
![]() | Domain d1bngb_: 1bng B: [36185] mutant |
PDB Entry: 1bng (more details), 2.1 Å
SCOPe Domain Sequences for d1bngb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bngb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]} intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl pgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir
Timeline for d1bngb_: