PDB entry 1bng

View 1bng on RCSB PDB site
Description: barnase s85c/h102c disulfide mutant
Class: endonuclease
Keywords: endonuclease
Deposited on 1995-03-31, released 1995-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.17
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: BARNASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (84)
      • conflict (101)
    Domains in SCOPe 2.06: d1bnga_
  • Chain 'B':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: BARNASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (84)
      • conflict (101)
    Domains in SCOPe 2.06: d1bngb_
  • Chain 'C':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: BARNASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (84)
      • conflict (101)
    Domains in SCOPe 2.06: d1bngc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bngA (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bngA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bngB (B:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bngB (B:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bngC (C:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bngC (C:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir