Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) |
Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) |
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) |
Protein Barnase/Binase [53944] (2 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries) |
Domain d1brsc_: 1brs C: [36165] Other proteins in same PDB: d1brsd_, d1brse_, d1brsf_ |
PDB Entry: 1brs (more details), 2 Å
SCOP Domain Sequences for d1brsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brsc_ d.1.1.1 (C:) Barnase/Binase {Bacillus amyloliquefaciens} vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
Timeline for d1brsc_: