Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) |
Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) |
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) |
Protein RNase Sa [53935] (1 species) |
Species Streptomyces aureofaciens [TaxId:1894] [53936] (12 PDB entries) |
Domain d1rsna_: 1rsn A: [36046] |
PDB Entry: 1rsn (more details), 2 Å
SCOP Domain Sequences for d1rsna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rsna_ d.1.1.1 (A:) RNase Sa {Streptomyces aureofaciens} dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp gartrgtrriicgeatqedyytgdhyatfslidqtc
Timeline for d1rsna_: