Lineage for d1rsna_ (1rsn A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28524Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 28525Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 28526Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 28641Protein RNase Sa [53935] (1 species)
  7. 28642Species Streptomyces aureofaciens [TaxId:1894] [53936] (12 PDB entries)
  8. 28659Domain d1rsna_: 1rsn A: [36046]

Details for d1rsna_

PDB Entry: 1rsn (more details), 2 Å

PDB Description: ribonuclease (rnase sa) (e.c.3.1.4.8) complexed with exo-2',3'-cyclophosphorothioate

SCOP Domain Sequences for d1rsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsna_ d.1.1.1 (A:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1rsna_:

Click to download the PDB-style file with coordinates for d1rsna_.
(The format of our PDB-style files is described here.)

Timeline for d1rsna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rsnb_