Lineage for d6hdsc_ (6hds C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2806418Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2806419Protein automated matches [190537] (10 species)
    not a true protein
  7. 2806420Species Afifella pfennigii [TaxId:209897] [360243] (3 PDB entries)
  8. 2806427Domain d6hdsc_: 6hds C: [360245]
    automated match to d4jnjd_

Details for d6hdsc_

PDB Entry: 6hds (more details), 1.74 Å

PDB Description: crystal structure of apo short afifavidin
PDB Compounds: (C:) Short afifavidin

SCOPe Domain Sequences for d6hdsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hdsc_ b.61.1.0 (C:) automated matches {Afifella pfennigii [TaxId: 209897]}
msprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplvgl
twgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgsdt
ftlvn

SCOPe Domain Coordinates for d6hdsc_:

Click to download the PDB-style file with coordinates for d6hdsc_.
(The format of our PDB-style files is described here.)

Timeline for d6hdsc_: