Lineage for d4jnjd_ (4jnj D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. Protein automated matches [190191] (2 species)
    not a true protein
  7. Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)
  8. Domain d4jnjd_: 4jnj D: [202751]
    automated match to d4jnja_
    complexed with btn, zn

Details for d4jnjd_

PDB Entry: 4jnj (more details), 1.9 Å

PDB Description: Structure based engineering of streptavidin monomer with a reduced biotin dissociation rate
PDB Compounds: (D:) Streptavidin/Rhizavidin Hybrid

SCOPe Domain Sequences for d4jnjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jnjd_ b.61.1.1 (D:) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewrve
wnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk

SCOPe Domain Coordinates for d4jnjd_ are not available.

Timeline for d4jnjd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4jnja_, d4jnjb_, d4jnjc_