PDB entry 6hds

View 6hds on RCSB PDB site
Description: Crystal Structure of apo short afifavidin
Class: biotin binding protein
Keywords: avidin, biotin, protein assembly, high affinity systems, dimeric avidins, biotin binding protein
Deposited on 2018-08-19, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short afifavidin
    Species: Afifella pfennigii [TaxId:209897]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HDS
    Domains in SCOPe 2.07: d6hdsa_
  • Chain 'B':
    Compound: Short afifavidin
    Species: Afifella pfennigii [TaxId:209897]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HDS
    Domains in SCOPe 2.07: d6hdsb_
  • Chain 'C':
    Compound: Short afifavidin
    Species: Afifella pfennigii [TaxId:209897]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HDS
    Domains in SCOPe 2.07: d6hdsc_
  • Chain 'D':
    Compound: Short afifavidin
    Species: Afifella pfennigii [TaxId:209897]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HDS
    Domains in SCOPe 2.07: d6hdsd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hdsA (A:)
    maqdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyp
    lvgltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqq
    gsdtftlvnkamk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdsA (A:)
    qdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplv
    gltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgs
    dtftlvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hdsB (B:)
    maqdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyp
    lvgltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqq
    gsdtftlvnkamk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdsB (B:)
    msprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplvgl
    twgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgsdt
    ftlvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hdsC (C:)
    maqdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyp
    lvgltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqq
    gsdtftlvnkamk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdsC (C:)
    msprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplvgl
    twgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgsdt
    ftlvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hdsD (D:)
    maqdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyp
    lvgltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqq
    gsdtftlvnkamk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdsD (D:)
    fgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplvgltwgnfigft
    vawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgsdtftlv