Lineage for d6hdsd_ (6hds D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. Protein automated matches [190537] (10 species)
    not a true protein
  7. Species Afifella pfennigii [TaxId:209897] [360243] (3 PDB entries)
  8. Domain d6hdsd_: 6hds D: [360254]
    automated match to d4jnjd_

Details for d6hdsd_

PDB Entry: 6hds (more details), 1.7400000000000002 Å

PDB Description: crystal structure of apo short afifavidin
PDB Compounds: (D:) Short afifavidin

SCOPe Domain Sequences for d6hdsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hdsd_ b.61.1.0 (D:) automated matches {Afifella pfennigii [TaxId: 209897]}
fgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplvgltwgnfigft
vawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgsdtftlv

SCOPe Domain Coordinates for d6hdsd_ are not available.

Timeline for d6hdsd_:

Domains from other chains:
(mouse over for more information)
d6hdsa_, d6hdsb_, d6hdsc_