Lineage for d1d6fa2 (1d6f A:236-389)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) - Fold c.95: Thiolase-like [53900] (1 superfamily)
- Superfamily c.95.1: Thiolase-like [53901] (2 families)
Family c.95.1.2: Chalcone synthase [53914] (2 proteins) Protein Chalcone synthase [53915] (1 species) Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (9 PDB entries) 
Domain d1d6fa2: 1d6f A:236-389 [35992]
Details for d1d6fa2
PDB Entry: 1d6f (more details), 1.69 Å
PDB Description: chalcone synthase c164a mutant
SCOP Domain Sequences for d1d6fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6fa2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa)}
ifemvwtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai
SCOP Domain Coordinates for d1d6fa2:
Click to download the PDB-style file with coordinates for d1d6fa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d6fa2:
- d1d6fa2 appears in SCOP 1.57
- d1d6fa2 appears in the current release, SCOPe 2.08
View in 3D
