SCOPe 2.07: Domain d6c39a2: 6c39 A:316-383

Lineage for d6c39a2 (6c39 A:316-383)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families)

5. Family b.105.1.0: automated matches [231757] (1 protein)
   not a true family

6. Protein automated matches [231758] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [352209] (2 PDB entries)

8. Domain d6c39a2: 6c39 A:316-383 [359749]
   Other proteins in same PDB: d6c39a1, d6c39b1
   automated match to d3huma2
   complexed with na, so4, zn

Details for d6c39a2

PDB Entry: 6c39, 1.69 Å

PDB Description: apo crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4)

PDB Compounds: (A:) Serine-type D-Ala-D-Ala carboxypeptidase

SCOPe Domain Sequences for d6c39a2:

Sequence; same for both SEQRES and ATOM records:

>d6c39a2 b.105.1.0 (A:316-383) automated matches {Staphylococcus aureus [TaxId: 1280]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

Timeline for d6c39a2:

• d6c39a2 is new in SCOPe 2.07-stable
  
• d6c39a2 appears in the current release, SCOPe 2.08