SCOPe 2.07: Domain d6c39a1: 6c39 A:25-315

Lineage for d6c39a1 (6c39 A:25-315)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [189852] (11 PDB entries)

8. Domain d6c39a1: 6c39 A:25-315 [359741]
   Other proteins in same PDB: d6c39a2, d6c39b2
   automated match to d3huna1
   complexed with na, so4, zn

Details for d6c39a1

PDB Entry: 6c39, 1.69 Å

PDB Description: apo crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4)

PDB Compounds: (A:) Serine-type D-Ala-D-Ala carboxypeptidase

SCOPe Domain Sequences for d6c39a1:

Sequence; same for both SEQRES and ATOM records:

>d6c39a1 e.3.1.1 (A:25-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

Timeline for d6c39a1:

• d6c39a1 is new in SCOPe 2.07-stable
  
• d6c39a1 appears in the current release, SCOPe 2.08