Lineage for d6c39a1 (6c39 A:25-315)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619561Species Staphylococcus aureus [TaxId:1280] [189852] (11 PDB entries)
  8. 2619572Domain d6c39a1: 6c39 A:25-315 [359741]
    Other proteins in same PDB: d6c39a2, d6c39b2
    automated match to d3huna1
    complexed with na, so4, zn

Details for d6c39a1

PDB Entry: 6c39 (more details), 1.69 Å

PDB Description: apo crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4)
PDB Compounds: (A:) Serine-type D-Ala-D-Ala carboxypeptidase

SCOPe Domain Sequences for d6c39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c39a1 e.3.1.1 (A:25-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

SCOPe Domain Coordinates for d6c39a1:

Click to download the PDB-style file with coordinates for d6c39a1.
(The format of our PDB-style files is described here.)

Timeline for d6c39a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c39a2