Lineage for d3huna1 (3hun A:25-315)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619100Protein Pencillin binding protein 4 (PbpD), N-terminal domain [111287] (1 species)
  7. 2619101Species Staphylococcus aureus [TaxId:1280] [111288] (3 PDB entries)
    Uniprot Q53613 21-383
  8. 2619104Domain d3huna1: 3hun A:25-315 [246572]
    Other proteins in same PDB: d3huna2, d3hunb2
    automated match to d3humb1
    complexed with zz7

Details for d3huna1

PDB Entry: 3hun (more details), 2 Å

PDB Description: crystal structure of penicillin binding protein 4 from staphylococcus aureus col in complex with ampicillin
PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d3huna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huna1 e.3.1.1 (A:25-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

SCOPe Domain Coordinates for d3huna1:

Click to download the PDB-style file with coordinates for d3huna1.
(The format of our PDB-style files is described here.)

Timeline for d3huna1:

2619104
d3huna1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3huna2