Class b: All beta proteins [48724] (178 folds) |
Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) |
Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein) rudiment form of the PBP-5-like domain automatically mapped to Pfam PF09211 |
Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [110100] (3 PDB entries) Uniprot Q53613 21-383 |
Domain d3huma2: 3hum A:316-382 [232513] Other proteins in same PDB: d3huma1, d3humb1 automated match to d1tvfa1 complexed with cew |
PDB Entry: 3hum (more details), 2.3 Å
SCOPe Domain Sequences for d3huma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3huma2 b.105.1.2 (A:316-382) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg pptvevh
Timeline for d3huma2: