Lineage for d6bftg_ (6bft G:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033578Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 3033590Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 3033593Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
    Uniprot P15692 40-133
  8. 3033630Domain d6bftg_: 6bft G: [359489]
    Other proteins in same PDB: d6bftb1, d6bftb2, d6bftl1, d6bftl2
    automated match to d4zffd_
    complexed with mes, so4; mutant

Details for d6bftg_

PDB Entry: 6bft (more details), 2.55 Å

PDB Description: structure of bevacizumab fab mutant in complex with vegf
PDB Compounds: (G:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d6bftg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bftg_ g.17.1.1 (G:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOPe Domain Coordinates for d6bftg_:

Click to download the PDB-style file with coordinates for d6bftg_.
(The format of our PDB-style files is described here.)

Timeline for d6bftg_: