Lineage for d5ynha2 (5ynh A:163-287)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766341Species Klebsiella pneumoniae [TaxId:573] [359373] (10 PDB entries)
  8. 2766350Domain d5ynha2: 5ynh A:163-287 [359463]
    Other proteins in same PDB: d5ynha1, d5ynha4, d5ynha5
    automated match to d2fhfa2
    complexed with ca, gol

Details for d5ynha2

PDB Entry: 5ynh (more details), 2.05 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 10 mm gamma-cyclodextrin
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynha2 b.1.18.0 (A:163-287) automated matches {Klebsiella pneumoniae [TaxId: 573]}
sradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvk
ltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtag
vlddt

SCOPe Domain Coordinates for d5ynha2:

Click to download the PDB-style file with coordinates for d5ynha2.
(The format of our PDB-style files is described here.)

Timeline for d5ynha2: