Lineage for d5ynha1 (5ynh A:29-162)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. Protein automated matches [254436] (5 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [359371] (9 PDB entries)
  8. Domain d5ynha1: 5ynh A:29-162 [359462]
    Other proteins in same PDB: d5ynha2, d5ynha3, d5ynha4, d5ynha5
    automated match to d2fhfa3
    complexed with ca, gol

Details for d5ynha1

PDB Entry: 5ynh (more details), 2.05 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 10 mm gamma-cyclodextrin
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynha1 b.3.1.0 (A:29-162) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dpqdvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdal
sapvadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftd
rtvsviagnsavyd

SCOPe Domain Coordinates for d5ynha1 are not available.

Timeline for d5ynha1:

Domains from same chain:
(mouse over for more information)
d5ynha2, d5ynha3, d5ynha4, d5ynha5