![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [359373] (10 PDB entries) |
![]() | Domain d5ynea2: 5yne A:163-287 [359413] Other proteins in same PDB: d5ynea1, d5ynea4, d5ynea5 automated match to d2fhfa2 complexed with ca, gol, peg |
PDB Entry: 5yne (more details), 2.2 Å
SCOPe Domain Sequences for d5ynea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ynea2 b.1.18.0 (A:163-287) automated matches {Klebsiella pneumoniae [TaxId: 573]} sradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvk ltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtag vlddt
Timeline for d5ynea2:
![]() Domains from same chain: (mouse over for more information) d5ynea1, d5ynea3, d5ynea4, d5ynea5 |