SCOPe 2.08: Domain d5ynea5: 5yne A:966-1083

Lineage for d5ynea5 (5yne A:966-1083)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [359378] (10 PDB entries)

8. Domain d5ynea5: 5yne A:966-1083 [359416]
   Other proteins in same PDB: d5ynea1, d5ynea2, d5ynea3, d5ynea4
   automated match to d2fhfa4
   complexed with ca, gol, peg

Details for d5ynea5

PDB Entry: 5yne, 2.2 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 10 mm alpha-cyclodextrin

PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynea5:

Sequence; same for both SEQRES and ATOM records:

>d5ynea5 b.71.1.0 (A:966-1083) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

Timeline for d5ynea5:

• d5ynea5 first appeared in SCOPe 2.07