Lineage for d5yhva1 (5yhv A:1-388)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505177Species Mycobacterium tuberculosis [TaxId:83332] [187938] (11 PDB entries)
  8. 2505208Domain d5yhva1: 5yhv A:1-388 [358648]
    Other proteins in same PDB: d5yhva2
    automated match to d1xi9c_
    complexed with akg, glu, gol, plp

Details for d5yhva1

PDB Entry: 5yhv (more details), 2.7 Å

PDB Description: crystal structure of an aminotransferase from mycobacterium tuberculosis
PDB Compounds: (A:) aminotransferase

SCOPe Domain Sequences for d5yhva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yhva1 c.67.1.0 (A:1-388) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtdrvalragvppfyvmdvwlaaaerqrthgdlvnlsagqpsagapepvraaaaaalhln
qlgysvalgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfdagdrvam
aspgypcyrnilsalgcevveipcgpqtrfqptaqmlaeidpplrgvvvaspanptgtvi
ppeelaaiaswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfskyyamtg
wrlgwllvptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasyainrsl
lldglrrigidrlaptdgafyvyadvsdftsdslafcsklladtgvaiapgidfdtargg
sfvrisfagpsgdieealrrigswlpsq

SCOPe Domain Coordinates for d5yhva1:

Click to download the PDB-style file with coordinates for d5yhva1.
(The format of our PDB-style files is described here.)

Timeline for d5yhva1: