![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [187938] (15 PDB entries) |
![]() | Domain d5yhva1: 5yhv A:1-388 [358648] Other proteins in same PDB: d5yhva2 automated match to d1xi9c_ complexed with akg, glu, gol, plp |
PDB Entry: 5yhv (more details), 2.7 Å
SCOPe Domain Sequences for d5yhva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yhva1 c.67.1.0 (A:1-388) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mtdrvalragvppfyvmdvwlaaaerqrthgdlvnlsagqpsagapepvraaaaaalhln qlgysvalgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfdagdrvam aspgypcyrnilsalgcevveipcgpqtrfqptaqmlaeidpplrgvvvaspanptgtvi ppeelaaiaswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfskyyamtg wrlgwllvptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasyainrsl lldglrrigidrlaptdgafyvyadvsdftsdslafcsklladtgvaiapgidfdtargg sfvrisfagpsgdieealrrigswlpsq
Timeline for d5yhva1: