Lineage for d6b1la1 (6b1l A:27-210)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969261Species Plasmodium vivax [TaxId:126793] [358012] (2 PDB entries)
  8. 2969268Domain d6b1la1: 6b1l A:27-210 [358013]
    automated match to d3iu1a1
    complexed with cj4, mya

Details for d6b1la1

PDB Entry: 6b1l (more details), 2.3 Å

PDB Description: crystal structure of glycylpeptide n-tetradecanoyltransferase from plasmodium vivax in complex with inhibitor imp-0001173
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d6b1la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b1la1 d.108.1.0 (A:27-210) automated matches {Plasmodium vivax [TaxId: 126793]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d6b1la1:

Click to download the PDB-style file with coordinates for d6b1la1.
(The format of our PDB-style files is described here.)

Timeline for d6b1la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b1la2
View in 3D
Domains from other chains:
(mouse over for more information)
d6b1lb1