SCOPe 2.07: Domain d6b1la1: 6b1l A:27-210

Lineage for d6b1la1 (6b1l A:27-210)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:126793] [358012] (2 PDB entries)

8. Domain d6b1la1: 6b1l A:27-210 [358013]
   automated match to d3iu1a1
   complexed with cj4, mya

Details for d6b1la1

PDB Entry: 6b1l, 2.3 Å

PDB Description: crystal structure of glycylpeptide n-tetradecanoyltransferase from plasmodium vivax in complex with inhibitor imp-0001173

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d6b1la1:

Sequence; same for both SEQRES and ATOM records:

>d6b1la1 d.108.1.0 (A:27-210) automated matches {Plasmodium vivax [TaxId: 126793]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

Timeline for d6b1la1:

• d6b1la1 is new in SCOPe 2.07-stable
  
• d6b1la1 appears in the current release, SCOPe 2.08