SCOPe 2.08: Domain d1mg1a1: 1mg1 A:6-370

Lineage for d1mg1a1 (1mg1 A:6-370)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
   Uniprot P02928

8. Domain d1mg1a1: 1mg1 A:6-370 [35790]
   Other proteins in same PDB: d1mg1a2
   chimera with HTLV-1 gp21 ectodomain
   complexed with cl
   has additional insertions and/or extensions that are not grouped together

Details for d1mg1a1

PDB Entry: 1mg1, 2.5 Å

PDB Description: htlv-1 gp21 ectodomain/maltose-binding protein chimera

PDB Compounds: (A:) protein (htlv-1 gp21 ectodomain/maltose-binding protein chimera)

SCOPe Domain Sequences for d1mg1a1:

Sequence; same for both SEQRES and ATOM records:

>d1mg1a1 c.94.1.1 (A:6-370) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
gklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwah
drfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpn
ppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvd
nagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygv
tvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgaval
ksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaalaaa
qtnaa

Timeline for d1mg1a1:

• d1mg1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1mg1a1 appears in SCOPe 2.07