Lineage for d1mdp2_ (1mdp 2:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250728Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 250729Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 250730Family c.94.1.1: Phosphate binding protein-like [53851] (19 proteins)
  6. 250741Protein D-maltodextrin-binding protein, MBP [53862] (3 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 250746Species Escherichia coli [TaxId:562] [53863] (29 PDB entries)
  8. 250765Domain d1mdp2_: 1mdp 2: [35785]
    complexed with mal; mutant

Details for d1mdp2_

PDB Entry: 1mdp (more details), 2.3 Å

PDB Description: refined structures of two insertion(slash)deletion mutants probe function of the maltodextrin binding protein

SCOP Domain Sequences for d1mdp2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdp2_ c.94.1.1 (2:) D-maltodextrin-binding protein, MBP {Escherichia coli}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipdpgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdnag
akagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvl
ptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalksy
eeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqtr
itk

SCOP Domain Coordinates for d1mdp2_:

Click to download the PDB-style file with coordinates for d1mdp2_.
(The format of our PDB-style files is described here.)

Timeline for d1mdp2_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mdp1_